PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G08190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 940aa    MW: 102758 Da    PI: 4.8592
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G08190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605.1e-1954100148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  LPERR01G08190.1  54 KGPWSKEEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 100
                      79******************************.*************97 PP

2Myb_DNA-binding47.34.8e-15106148145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
  LPERR01G08190.1 106 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 148
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-44261IPR009057Homeodomain-like
PROSITE profilePS5129431.40449104IPR017930Myb domain
SuperFamilySSF466891.05E-3051147IPR009057Homeodomain-like
SMARTSM007172.2E-1753102IPR001005SANT/Myb domain
PfamPF002493.1E-1754100IPR001005SANT/Myb domain
CDDcd001674.72E-1556100No hitNo description
Gene3DG3DSA:1.10.10.606.1E-2662108IPR009057Homeodomain-like
SMARTSM007174.4E-14105153IPR001005SANT/Myb domain
PROSITE profilePS5129419.654105155IPR017930Myb domain
PfamPF002491.8E-13106149IPR001005SANT/Myb domain
CDDcd001676.59E-11108148No hitNo description
Gene3DG3DSA:1.10.10.606.6E-21109155IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 940 aa     Download sequence    Send to blast
MSSDNGKAPE KGGESSGPPS APQEGGLLDR QGVPPKEIGP LKRWQKVLNP ELVKGPWSKE  60
EDDIIVQMVN KLGPKKWSTI AQALPGRIGK QCRERWHNHL NPGINKEAWT QEEEITLIHA  120
HRMYGNKWAE LTKFLPGRTD NAIKNHWNSS VKKKVDSYMS SGLLSQVSCL PLNEYPAHCN  180
SSPAMTQQNS EDSGCYAVRE VENSSGCSQS SLAKVSCSQV HNANVALGCE LQVHANVDKN  240
EIHDSQSSVG QEACYTSSEL VPSAIPEVHY HASSSNFDPD QHLQEEFAQG LNLHMSIDEV  300
PNDSNFADNQ NICSIENHER SLVPYDVAME MPISMLPSDS GAEQKLHFMS EADFNSPNCL  360
KSELWQDISL QSLLSGPDAV ETDSFSRSNH QTDVYSSKAD TEFLAPSYLL QTSNSSNVME  420
ATYGQCPQMS VSPSFVSSNV MTDAPSDNRP EPKEMRVSQA EVVTESSISS GDAELFANPG  480
SSNDMHVPSM MESIPEGGDQ QVANAAEPEA GIELTQGVTA SDEKQDEGAL FYEPPRFPSL  540
DVPFVSCDLV TSSDLQEYSP LGIRQLMRST MNVCTPMRLW GSPTHDESPD ILLKSAAKSF  600
ICTPSILKKR HRDLLSPIPD KRIEKKSGTE KDRGVSDISS VGIQTGCANA TNDDAVIIKS  660
VLRIERSASS KPLEKKLEFA DEHKETLSYR TEQAKDGQSG GDDKHMDEQT KGEQRSATNT  720
TTTYDNVPGN QPAGILVEHS GDLVSPDYGK SAMNQKRKTN MESLSACKEG LSAKSKPAEL  780
IVEKSSPCIN VDYEYVNILA DTPGIKRGLE SPSAWKSPWF VDMQFQGSYF VSPADRSYDA  840
LGLVKQINVQ TAAALAEARE VLASGGQSDN INSDKENMKN PDAKEPGATK LQTKIMTEGR  900
VLDFNECTTP VRSSERKAGS SLGRSLSSPI PSSHLLRNFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-524315547159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-524315547159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4300510.0AJ430051.1 Oryza sativa mRNA for transcription factor myb (myb3R1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006643940.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A0D9UYS90.0A0A0D9UYS9_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g13570.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.25e-75myb domain protein 3r-4